PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G33780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 575aa    MW: 62093.1 Da    PI: 5.9538
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G33780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS353.14.4e-1082065753374
             GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      + Ll+c +a ++ d  la a La ++  a+ +gdp +Rla+yf+ AL++rla    ++ +  +++++++  s+e +  +k++++++P+ kf+hl
  ORUFI03G33780.1 206 QSLLSCSRAAAT-DPGLAAAELASVRAAATDAGDPSERLAFYFADALSRRLAC---GTGAPPSAEPDARFASDELTLCYKTLNDACPYSKFAHL 295
                      7899**998776.89999999*******************************8...5555555566666669999******************* PP

             GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      taNqaIlea+  ++++Hi+Df+i qG+QW+aLlqaLa+Rpeg+p ++RiTgv sp  g   + +l +t+ rL++fA+ lgv+fef + + + ++
  ORUFI03G33780.1 296 TANQAILEATGAATKIHIVDFGIVQGIQWAALLQALATRPEGKPtRIRITGVPSPLLGpqPAASLAATNTRLRDFAKLLGVDFEFVP-LLRPVH 388
                      ****************************************88777*********998888999************************.599*** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                      +l+ +++ v+p+Ea+aVn++lql++ll +s +l     +vL+l kslsP vv++ e e+++n++ F++rf++al+yy +lf+sl++ + r+s e
  ORUFI03G33780.1 389 ELNKSDFLVEPDEAVAVNFMLQLYHLLGDSDELVR---RVLRLAKSLSPAVVTLGEYEVSLNRAGFVDRFANALSYYRSLFESLDVAMTRDSPE 479
                      ***************************88888877...******************************************************** PP

             GRAS 282 rikvErellgreivnvva.cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSa 372
                      r+ vEr ++g++i+ +v   ega+r+er+   ++W+  +e +GF+pvpls++a +qa+lll +++ +  y++ e   +++ l W++rpL++vSa
  ORUFI03G33780.1 480 RVRVERWMFGERIQRAVGpEEGADRTERMAGSSEWQTLMEWCGFEPVPLSNYARSQADLLLWNYDsKYKYSLVELPPAFLsLAWEKRPLLTVSA 573
                      *****************8356889*****************************************7778999999999988************* PP

             GRAS 373 Wr 374
                      Wr
  ORUFI03G33780.1 574 WR 575
                      *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.782178553IPR005202Transcription factor GRAS
PfamPF035141.5E-105206575IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QQQQQQQRHH HHHHLPPPPP PQSMAPHHHQ QKHHHHHQQM  60
PAMPQAPPSS HGQIPGQLAY GGGAAWPAGE HFFADAFGAS AGDAVFSDLA AAADFDSDGW  120
MESLIGDAPF QDSDLERLIF TTPPPPVPSP PPTHAAATAT ATAATAAPRP EAAPALLPQP  180
AAATPVACSS PSPSSADASC SAPILQSLLS CSRAAATDPG LAAAELASVR AAATDAGDPS  240
ERLAFYFADA LSRRLACGTG APPSAEPDAR FASDELTLCY KTLNDACPYS KFAHLTANQA  300
ILEATGAATK IHIVDFGIVQ GIQWAALLQA LATRPEGKPT RIRITGVPSP LLGPQPAASL  360
AATNTRLRDF AKLLGVDFEF VPLLRPVHEL NKSDFLVEPD EAVAVNFMLQ LYHLLGDSDE  420
LVRRVLRLAK SLSPAVVTLG EYEVSLNRAG FVDRFANALS YYRSLFESLD VAMTRDSPER  480
VRVERWMFGE RIQRAVGPEE GADRTERMAG SSEWQTLMEW CGFEPVPLSN YARSQADLLL  540
WNYDSKYKYS LVELPPAFLS LAWEKRPLLT VSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.02015751375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1469360.0AC146936.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 3 clone B1154F06 map near C10769, complete sequence.
GenBankAK0640220.0AK064022.1 Oryza sativa Japonica Group cDNA clone:001-125-A04, full insert sequence.
GenBankAK1016030.0AK101603.1 Oryza sativa Japonica Group cDNA clone:J033051K20, full insert sequence.
GenBankAK1028570.0AK102857.1 Oryza sativa Japonica Group cDNA clone:J033110P03, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628849.10.0PREDICTED: scarecrow-like protein 4
TrEMBLA0A0E0P0M50.0A0A0E0P0M5_ORYRU; Uncharacterized protein
STRINGBGIOSGA013482-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g51330.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-143GRAS family protein